Keyword Ranking Analysis for QMAX MST 99 V2


Keyword Summary

Keyword: qmax mst 99 v2
Global Monthly Searches:
CPC: $0.00
Date Checked: 2015/11/29

Navigation

  • Keyword Competitor Analysis

  • What is the purpose of the Keyword Ranking Analysis Report?

    The purpose of our Keyword Ranking Analysis Report is to assess how competitive a market is for a specific keyword. In other words we check how hard it will be for a website to rank in Google for the specific keyword.

    What information is displayed in this report?

    We analyse the first 30 domains to determine their competitive advantage by looking at available statistic of the domain.

  • Domain: The URL of the website ranked in Google for the keyword.
  • Page Title: The title of the page ranked in Google. This is the text located within the title tag. Your main keyword should appear in the title of the page.
  • Position: The position of the website for the keyword within Google SERPS.
  • Google PageRank: A number that Google assigns to each web page on the internet to determine how much authority the domain / url has.
  • Google PageIndexed: The number of pages indexed by Google for the specific domain.
  • Bing PageIndexed: The number of pages indexed by Bing for the specific domain.
  • Keyword in Domain: We check if the keyword is contained in the domain name. This is important for onsite optimization.
  • Keyword in Url: We check if the keyword is contained in the Url of the page. This is important for onsite optimization.
  • Keyword in Title: We check if the keyword is contained in the title of the page. This is important for onsite optimization.
  • How to run this report

    Please enter the keyword you would like to search for in the text box above, and press the "search" button.



    Keyword Competitor Analysis:

    Domain / Title / UrlPositionGoogle PageRankGoogle Pages IndexedBing Pages IndexedKeyword In DomainKeyword In UrlKeyword In Title
    soft4sat.com 3 1 20,900
    youtube.com 10 9 2,010,000,000 1,030,000,000
    mohandsen.net 11 1 901,000 3
    traidnt.net 12 5 360,000
    ostazsat.com 13 1 355,000 18
    ostazsat.com 14 1 355,000 18
    ostazsat.net 15 2 599,000 42
    ahmed2010.dahek.net 20 3 6,410 622
    egypt.souq.com

    offers for Qmax mst-999 HD V2 - Egypt - Souq.com
    Path: /eg-en/qmax-mst-999-hd-v2-4563690/io/
    22 4 530,000 4,340
    askmefast.com

    I would like to have ts files recorded from Qmax v2 mst 999 ...
    Path: /I_would_like_to_have_ts_files_recorded_from_Qmax_v2_mst_999_for_mezzo_scranbled_channel_to_be_working_on_PC-qna6184887.html
    23 5 1,690,000
    keyrow.com

    qmax mst 999 - keyword - Check
    Path: /data/?k=qmax+mst+999
    36 3 32,000,000 91,400
    mido-sat.com 43 1 185,000 5
    fannansatsoka.com 45 1 312,000 2,070
    netkeysat.net

    25 - Netkeysat.net
    Path: /index.php?pagina=25
    46 3 345 10
    sat-universe.com 51 3 7,840
    startimes.com 52 6 5,070,000 150,000
    fannannsat.com 53 2 198,000 42,700
    sciencedirect.com

    PDF (165 K) - ScienceDirect.com
    Path: /science/article/pii/S0304397599001309/pdf?md5=00b61125d3b90af2bf226c381bffb0f1&pid=1-s2.0-S0304397599001309-main.pdf
    60 9 8,110,000 1,700,000
    shbool-sat.com 61 1 140,000 9
    nokiamoon.com 62 2
    www2.clubme.net 63 0 78
    fastersearch.ir

    DIGITEL RECIEVERS SOFTWARE - New Microsoft Update
    Path: /cjcdnjctdqrnmnsvdmnvcvndnsdcacyrctdtdf.html
    64
    afriqa-sat.com 65
    asiw.net

    ملفات القنوات للكيوماكس 999 و ...
    Path: /more/18393_8/?????-???????-?????????-999-?.html
    66
    downloadfreesharedfiles.com

    Qmax mst 999 h3 server - Download
    Path: /qmax-mst-999-h3-server.html
    68 3 683,000 3,320
    digital-eliteboard.com

    Talk Kennt jemand STARSAT? STARSAT SR-2000 HD ACE [Archiv ...
    Path: /archive/index.php/t-284268.html
    73 2 1,500,000 103,000
    damasgate.com 83 3 1,210,000 42
    cse.unsw.edu.au

    Topology Control and Channel Assignment in Multi ... - CSE
    Path: /~salilk/papers/conferences/MASS2007.pdf
    91 4 303,000 40
    afzhan.com

    ROSS EXICO GmbHES2.B322002 NBN4-12GM40-Z0阀 ...
    Path: /st146726/Price_4835853.html
    95 5 4,790,000 19,400
    2cto.com 97 5 1,660,000 32,800