Keyword Ranking Analysis for JURNAL MUTU PELAYANAN KEBIDANAN


Keyword Summary

Keyword: jurnal mutu pelayanan kebidanan
Global Monthly Searches:
CPC: $0.00
Date Checked: 2012/04/14

Navigation

  • Keyword Competitor Analysis

  • What is the purpose of the Keyword Ranking Analysis Report?

    The purpose of our Keyword Ranking Analysis Report is to assess how competitive a market is for a specific keyword. In other words we check how hard it will be for a website to rank in Google for the specific keyword.

    What information is displayed in this report?

    We analyse the first 30 domains to determine their competitive advantage by looking at available statistic of the domain.

  • Domain: The URL of the website ranked in Google for the keyword.
  • Page Title: The title of the page ranked in Google. This is the text located within the title tag. Your main keyword should appear in the title of the page.
  • Position: The position of the website for the keyword within Google SERPS.
  • Google PageRank: A number that Google assigns to each web page on the internet to determine how much authority the domain / url has.
  • Google PageIndexed: The number of pages indexed by Google for the specific domain.
  • Bing PageIndexed: The number of pages indexed by Bing for the specific domain.
  • Keyword in Domain: We check if the keyword is contained in the domain name. This is important for onsite optimization.
  • Keyword in Url: We check if the keyword is contained in the Url of the page. This is important for onsite optimization.
  • Keyword in Title: We check if the keyword is contained in the title of the page. This is important for onsite optimization.
  • How to run this report

    Please enter the keyword you would like to search for in the text box above, and press the "search" button.



    Keyword Competitor Analysis:

    Domain / Title / UrlPositionGoogle PageRankGoogle Pages IndexedBing Pages IndexedKeyword In DomainKeyword In UrlKeyword In Title
    creasoft.wordpress.com

    jurnal « Referensi Kesehatan
    Path: /category/keperawatankesehatan-masyarakatkebidanan/jurnal/
    1 2 1,100 2
    scribd.com

    Penilaian Mutu Pelayanan Kebidanan
    Path: /doc/7073620/Penilaian-Mutu-Pelayanan-Kebidanan
    2 8 18,700,000 8,730,000
    scribd.com

    Mutu Pelayanan
    Path: /doc/28364325/Mutu-Pelayanan
    3 8 18,700,000 8,730,000
    webstatschecker.com

    jurnal mutu pelayanan jampersal - Keyword Stats
    Path: /stats/keyword/jurnal_mutu_pelayanan_jampersal
    10 4 49,000,000 914,000
    webstatschecker.com

    tingkat kepuasan pasien terhadap pelayanan jampersal - Keyword
    Path: /stats/keyword/tingkat_kepuasan_pasien_terhadap_pelayanan_jampersal
    11 4 49,000,000 914,000
    contohskripsiku.com

    Jurnal Mutu Pelayanan Kebidanan - Contoh Skripsi
    Path: /pdf/jurnal+mutu+pelayanan+kebidanan
    12 1
    contohskripsiku.com

    Jurnal Penelitian Mutu Pelayanan Kebidanan - Contoh Skripsi
    Path: /pdf/jurnal+penelitian+mutu+pelayanan+kebidanan
    13 1
    isjd.pdii.lipi.go.id

    jurnal Media Kebidanan Poltekkes Makassar
    Path: /admin/jurnal/221083100_2087-1325.pdf
    16 5 100,000 3,790
    jurnal.pdii.lipi.go.id

    Jurnal Infokes STIKES Insan Unggul Surabaya HUBUNGAN
    Path: /admin/jurnal/22102734_2085-028X.pdf
    17 5 26,500 5
    pdf-searcher.org

    PENGARUH-PERSEPSI-MUTU-PELAYANAN-KEBIDANAN
    Path: /PENGARUH-PERSEPSI-MUTU-PELAYANAN-KEBIDANAN-TERHADAP-KEPUASAN-....html
    19 1 678,000 4,850
    pdf-searcher.org 20 1 678,000 4,850
    jurnalskripsi.net

    Analisis Pengaruh Kualitas Pelayanan Terhadap - Jurnal Skripsi
    Path: /pdf/analisis-pengaruh-kualitas-pelayanan-terhadap-kepuasan-pasien/page/2/
    22 1 26,100
    keren.web.id

    PENGARUH KESEHATAN DAN GIZI TERHADAP TINGKAT
    Path: /pengaruh-kesehatan-dan-gizi-terhadap-tingkat-kemiskinan.html
    25 1 1,630 505
    infobencana.web.id

    artikel tentang mutu pelayanan kebidanan pdf no « Search Results
    Path: /id/%3Fs=artikel+tentang+mutu+pelayanan+kebidanan+pdf+no
    30 1 208,000 3
    journal.unair.ac.id

    Public Health Center's State and Function in - Journal | Unair
    Path: /detail_jurnal.php%3Fid=2355&med=6&bid=3
    32 5 342
    fkm.undip.ac.id

    PUSAT DATA JURNAL dan SKRIPSI
    Path: /data/index.php%3Faction=4&idx=2827
    56 5 8,880 3
    ebookpdfgratis.com

    analisis persepsi pasien terhadap kepuasan | Search Results
    Path: /pdf/analisis-persepsi-pasien-terhadap-kepuasan.html
    58 1 1,580,000 1,160
    jurnalskripsi.com

    PENGARUH KUALITAS PELAYANAN - Referensi Jurnal & Skripsi
    Path: /pengaruh-kualitas-pelayanan-terhadap-kepuasan-nasabah-studi-pada-peserta-komersial-asuransi-kesehatan-di-ptpersero-asuransi-kesehatan-indonesia-kantor-cabang-malang-pdf.htm
    60 1 17,400 9,780
    ihqn.or.id

    Bulletin IHQN
    Path: /%3Fdl_id=62
    65 3
    streamzon3.web.id

    Jurnal Manajemen Pelayanan Kesehatan Pdf | Cheat Game Stream
    Path: /stream-jurnal-manajemen-pelayanan-kesehatan-pdf
    76 1 1,480,000 75
    repository.usu.ac.id

    PERSEPSI MASYARAKAT TERHADAP KUALITAS PELAYANAN
    Path: /bitstream/123456789/19330/1/ikm-des2007-11%2520(7).pdf
    77 6 25,900
    journal.ui.ac.id

    HUBUNGAN KEPUASAN PASIEN BAYAR DENGAN
    Path: /upload/artikel/07_Ellya%2520Niken_HUBUNGAN%2520KEPUASAN%2520PASIEN_Layout.pdf
    79 6 14,000 863
    journal.uii.ac.id

    PEMANFAATAN MODEL STRATEGIC ALIGNMENT UNTUK - Journal
    Path: /index.php/Snati/article/view/1215/1012
    84 5 3,700
    slideshare.net

    Kualitas Pelayanan Sektor Publik ... (Haris Faozan, 2001)
    Path: /G69/kualitas-pelayanan-sektor-publik-haris-faozan-2001-2504191
    85 8 64,000,000 7,460,000
    jmpk-online.net

    jmpk-online.net
    Path: /
    86 3
    papuaweb.org

    1. ANTROPOLOGI DAN KONSEP KEBUDAYAAN 2. PENERAPAN
    Path: /uncen/dlib/jr/antropologi/01-01/jurnal.pdf
    89 6 3,260 4
    dinkes-sulsel.go.id

    Jurnal Manajemen Pelayanan Kesehatan ANALISIS JUMLAH
    Path: /new/images/pdf/jurnal/analisis%2520tenaga.pdf
    91 5
    docslibrary.com

    Jurnal Kesehatan Masyarakat Tentang Kesehatan Reproduksi
    Path: /pdf/jurnal+kesehatan+masyarakat+tentang+kesehatan+reproduksi
    92 2 3,880,000 39,700
    poltekkes-malang.ac.id

    Artikel - Poltekkes Malang
    Path: /artikel-163.html
    96 3
    ipdfsearchengine.com 98 1 804,000