Keyword Ranking Analysis for GAMBARAN SIKAP WANITA MENOPOUSE TERHADAP PERUBAHAN PSIKOLOGIS DALAM MASA MENOPOUSE


Keyword Summary

Keyword: gambaran sikap wanita menopouse terhadap perubahan psikologis dalam masa menopouse
Global Monthly Searches:
CPC: $0.00
Date Checked: 2013/01/29

Navigation

  • Keyword Competitor Analysis

  • What is the purpose of the Keyword Ranking Analysis Report?

    The purpose of our Keyword Ranking Analysis Report is to assess how competitive a market is for a specific keyword. In other words we check how hard it will be for a website to rank in Google for the specific keyword.

    What information is displayed in this report?

    We analyse the first 30 domains to determine their competitive advantage by looking at available statistic of the domain.

  • Domain: The URL of the website ranked in Google for the keyword.
  • Page Title: The title of the page ranked in Google. This is the text located within the title tag. Your main keyword should appear in the title of the page.
  • Position: The position of the website for the keyword within Google SERPS.
  • Google PageRank: A number that Google assigns to each web page on the internet to determine how much authority the domain / url has.
  • Google PageIndexed: The number of pages indexed by Google for the specific domain.
  • Bing PageIndexed: The number of pages indexed by Bing for the specific domain.
  • Keyword in Domain: We check if the keyword is contained in the domain name. This is important for onsite optimization.
  • Keyword in Url: We check if the keyword is contained in the Url of the page. This is important for onsite optimization.
  • Keyword in Title: We check if the keyword is contained in the title of the page. This is important for onsite optimization.
  • How to run this report

    Please enter the keyword you would like to search for in the text box above, and press the "search" button.



    Keyword Competitor Analysis:

    Domain / Title / UrlPositionGoogle PageRankGoogle Pages IndexedBing Pages IndexedKeyword In DomainKeyword In UrlKeyword In Title
    repository.usu.ac.id

    BAB II TINJAUAN PUSTAKA 2.1 Defenisi Menopause Menopause
    Path: /bitstream/123456789/21262/4/Chapter%2520II.pdf
    2 6 25,900
    4-akbid.blogspot.com

    KECEMASAN TERHADAP PERUBAHAN FISIK WANITA USIA 45-55
    Path: /2011/01/kecemasan-terhadap-perubahan-fisik.html
    6 0 106 46
    scribd.com

    Kti Menopause - Scribd
    Path: /doc/84231629/Kti-Menopause
    7 8 18,700,000 8,730,000
    docstoc.com

    SKRIPSI BIDAN PENDIDIK
    Path: /docs/124654638/SKRIPSI-BIDAN-PENDIDIK
    10 7 5,420,000
    library.upnvj.ac.id

    BAB II TINJAUAN PUSTAKA Dalam bab ini akan dibahas tentang
    Path: /pdf/s1keperawatan08/204312066/bab2.pdf
    14 76,500 1,730
    creasoft.wordpress.com

    lansia « Referensi Kesehatan
    Path: /tag/lansia/
    20 2 1,100 2
    bidansmart.files.wordpress.com

    Masalah Seksual Pada Lansia
    Path: /2010/03/seksual-pada-lansia.docx
    22 3
    digilib.unimus.ac.id

    BAB 2.pdf
    Path: /files/disk1/107/jtptunimus-gdl-fatimahg2a-5306-3-bab2.pdf
    26 2 75,600 184
    scribd.com

    Kti Menopause - Scribd
    Path: /doc/82838704/Kti-Menopause
    27 8 18,700,000 8,730,000
    digilib.unimus.ac.id

    karya tulis ilmiah hubungan tingkat pengetahuan dan pendidikan
    Path: /files/disk1/118/jtptunimus-gdl-fauzankoni-5852-1-babi.pdf
    34 2 75,600 184
    isjd.pdii.lipi.go.id

    Download File - ISJD PDII LIPI
    Path: /admin/jurnal/21115156.pdf
    35 5 100,000 3,790
    docstoc.com

    GANGGUAN PSIKOLOGIS PADA WANITA MENOPAUSE
    Path: /docs/49296114/GANGGUAN-PSIKOLOGIS-PADA-WANITA-MENOPAUSE
    36 7 5,420,000
    repository.usu.ac.id

    Beberapa Faktor Yang Mempengaruhi Menopause Pada Wanita
    Path: /bitstream/123456789/14625/1/09E01078.pdf
    39 6 25,900
    scribd.com

    rhaa kti
    Path: /doc/84458600/rhaa-kti
    58 8 18,700,000 8,730,000
    library.upnvj.ac.id

    BAB II.pdf - upn veteran jakarta
    Path: /pdf/5FIKESS1KEPERAWATAN/1010712051/BAB%2520II.pdf
    59 76,500 1,730
    repository.usu.ac.id

    BAB II TINJAUAN PUSTAKA 2.1. Konsep Perilaku Perilaku adalah
    Path: /bitstream/123456789/34477/4/Chapter%2520II.pdf
    60 6 25,900
    repository.usu.ac.id

    Chapter II.pdf - USU Institutional Repository
    Path: /bitstream/123456789/31861/4/Chapter%2520II.pdf
    62 6 25,900
    scribd.com

    Bab II Kista Ovarium Nita
    Path: /doc/99610503/Bab-II-Kista-Ovarium-Nita
    63 8 18,700,000 8,730,000
    digilib.unimus.ac.id 64 2 75,600 184
    digilib.sunan-ampel.ac.id

    11 BAB II KAJIAN TEORITIK A. STRESS 1. Definisi Stres Kata “stres
    Path: /files/disk1/172/jiptiain--zulistiana-8569-3-babll.pdf
    68 3
    keluargacemara.com

    Stres dan Penanggulangannya | Psikologi
    Path: /psikologi/stres-dan-penanggulangannya.html
    75 2
    creasoft.wordpress.com

    Kesehatan Reproduksi Dewasa « Referensi Kesehatan
    Path: /category/keperawatankesehatan-masyarakatkebidanan/kesehatan-reproduksi/kesehatan-reproduksi-dewasa/page/2/
    77 2 1,100 2
    slideshare.net

    Maternitas
    Path: /rakkas/maternitas
    78 8 64,000,000 7,460,000
    scribd.com

    BREPRODUKSI PADA WANITA for 20090610171945 Kelas 11
    Path: /doc/105868907/49/BREPRODUKSI-PADA-WANITA
    82 8 18,700,000 8,730,000
    docstoc.com

    seksual pada lansia
    Path: /docs/110832305/seksual-pada-lansia
    87 7 5,420,000
    repository.usu.ac.id

    STUDI BANDING DENSITAS MINERAL TULANG PADA MASA
    Path: /bitstream/123456789/21854/4/Chapter%2520II.pdf
    88 6 25,900
    keluargacemara.com

    Sepuluh Perangkat Penting dalam Pengasuhan yang Positif
    Path: /keluarga/sepuluh-perangkat-penting-dalam-pengasuhan-yang-positif.html
    91 2
    scribd.com

    seksual-pada-lansia
    Path: /doc/83189381/seksual-pada-lansia
    93 8 18,700,000 8,730,000
    creasoft.wordpress.com

    Kesehatan Reproduksi « Referensi Kesehatan
    Path: /category/keperawatankesehatan-masyarakatkebidanan/kesehatan-reproduksi/page/2/
    97 2 1,100 2
    digilib.sunan-ampel.ac.id

    10 BAB II KAJIAN PUSTAKA A. Teori-Teori 1. Single parent a
    Path: /files/disk1/197/jiptiain--amirotulkh-9822-5-babii.pdf
    98 3